![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein HslV (ClpQ) protease [56258] (4 species) dodecameric prokaryotic homologue of proteasome |
![]() | Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries) |
![]() | Domain d1kyio_: 1kyi O: [73237] Other proteins in same PDB: d1kyia_, d1kyib_, d1kyic_, d1kyid_, d1kyie_, d1kyif_, d1kyis_, d1kyit_, d1kyiu_, d1kyiv_, d1kyiw_, d1kyix_ complexed with atp, lvs |
PDB Entry: 1kyi (more details), 3.1 Å
SCOPe Domain Sequences for d1kyio_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyio_ d.153.1.4 (O:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
Timeline for d1kyio_: