Lineage for d1kyil_ (1kyi L:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 263343Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 263344Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 263459Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 263460Protein HslV (ClpQ) protease [56258] (2 species)
    dodecameric prokaryotic homologue of proteasome
  7. 263497Species Haemophilus influenzae [TaxId:727] [56260] (4 PDB entries)
  8. 263509Domain d1kyil_: 1kyi L: [73234]
    Other proteins in same PDB: d1kyia_, d1kyib_, d1kyic_, d1kyid_, d1kyie_, d1kyif_, d1kyis_, d1kyit_, d1kyiu_, d1kyiv_, d1kyiw_, d1kyix_

Details for d1kyil_

PDB Entry: 1kyi (more details), 3.1 Å

PDB Description: HslUV (H. influenzae)-NLVS Vinyl Sulfone Inhibitor Complex
PDB Compounds: (L:)

SCOP Domain Sequences for d1kyil_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyil_ d.153.1.4 (L:) HslV (ClpQ) protease {Haemophilus influenzae}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

SCOP Domain Coordinates for d1kyil_:

Click to download the PDB-style file with coordinates for d1kyil_.
(The format of our PDB-style files is described here.)

Timeline for d1kyil_: