Lineage for d1kyie_ (1kyi E:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 832094Family c.37.1.20: Extended AAA-ATPase domain [81269] (28 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 832226Protein HslU [52721] (2 species)
    ATPase subunit of ATP-dependent protease
  7. 832258Species Haemophilus influenzae [TaxId:727] [52723] (6 PDB entries)
  8. 832268Domain d1kyie_: 1kyi E: [73227]
    Other proteins in same PDB: d1kyig_, d1kyih_, d1kyii_, d1kyij_, d1kyik_, d1kyil_, d1kyim_, d1kyin_, d1kyio_, d1kyip_, d1kyiq_, d1kyir_

Details for d1kyie_

PDB Entry: 1kyi (more details), 3.1 Å

PDB Description: HslUV (H. influenzae)-NLVS Vinyl Sulfone Inhibitor Complex
PDB Compounds: (E:) ATP-dependent hsl protease ATP-binding subunit hslu

SCOP Domain Sequences for d1kyie_:

Sequence, based on SEQRES records: (download)

>d1kyie_ c.37.1.20 (E:) HslU {Haemophilus influenzae [TaxId: 727]}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
daayvadalgevvenedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1kyie_ c.37.1.20 (E:) HslU {Haemophilus influenzae [TaxId: 727]}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknaaklinpee
lkqkaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhi
lfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmate
gvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnida
ayvadalgevvenedlsrfil

SCOP Domain Coordinates for d1kyie_:

Click to download the PDB-style file with coordinates for d1kyie_.
(The format of our PDB-style files is described here.)

Timeline for d1kyie_: