Lineage for d1kyic_ (1kyi C:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180169Family c.37.1.13: Extended AAA-ATPase domain [52700] (17 proteins)
  6. 180232Protein HslU [52721] (2 species)
  7. 180262Species Haemophilus influenzae [TaxId:727] [52723] (4 PDB entries)
  8. 180267Domain d1kyic_: 1kyi C: [73225]
    Other proteins in same PDB: d1kyig_, d1kyih_, d1kyii_, d1kyij_, d1kyik_, d1kyil_, d1kyim_, d1kyin_, d1kyio_, d1kyip_, d1kyiq_, d1kyir_

Details for d1kyic_

PDB Entry: 1kyi (more details), 3.1 Å

PDB Description: HslUV (H. influenzae)-NLVS Vinyl Sulfone Inhibitor Complex
PDB Compounds: (C:)

SCOP Domain Sequences for d1kyic_:

Sequence, based on SEQRES records: (download)

>d1kyic_ c.37.1.13 (C:) HslU {Haemophilus influenzae}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
daayvadalgevvenedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1kyic_ c.37.1.13 (C:) HslU {Haemophilus influenzae}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknaaklinpee
lkqkaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhi
lfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmate
gvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnida
ayvadalgevvenedlsrfil

SCOP Domain Coordinates for d1kyic_:

Click to download the PDB-style file with coordinates for d1kyic_.
(The format of our PDB-style files is described here.)

Timeline for d1kyic_: