Lineage for d1kyha_ (1kyh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137615Family c.72.1.4: YjeF C-terminal domain-like [75292] (3 protein domains)
    automatically mapped to Pfam PF01256
  6. 2137639Protein Hypothetical protein YxkO [75293] (1 species)
  7. 2137640Species Bacillus subtilis [TaxId:1423] [75294] (1 PDB entry)
  8. 2137641Domain d1kyha_: 1kyh A: [73222]
    structural genomics

Details for d1kyha_

PDB Entry: 1kyh (more details), 1.6 Å

PDB Description: structure of bacillus subtilis yxko, a member of the upf0031 family and a putative kinase
PDB Compounds: (A:) Hypothetical 29.9 kDa protein in SIGY-CYDD intergenic region

SCOPe Domain Sequences for d1kyha_:

Sequence, based on SEQRES records: (download)

>d1kyha_ c.72.1.4 (A:) Hypothetical protein YxkO {Bacillus subtilis [TaxId: 1423]}
nvpfwteehvratlperdaeshkgtygtalllagsddmpgaallaglgamrsglgklvig
tsenviplivpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdhvlta
dcpvildagalakrtypkregpviltphpgeffrmtgvpvnelqkkraeyakewaaqlqt
vivlkgnqtviafpdgdcwlnptgngalakggtgdtltgmilgmlcchedpkhavlnavy
lhgacaelwtdehsahtllahelsdilprvwkrfe

Sequence, based on observed residues (ATOM records): (download)

>d1kyha_ c.72.1.4 (A:) Hypothetical protein YxkO {Bacillus subtilis [TaxId: 1423]}
nvpfwteehvratlpertygtalllagsddmpgaallaglgamrsglgklvigtsenvip
livpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdhvltadcpvild
agalakrtypkregpviltphpgeffrmtgvpvnelqkkraeyakewaaqlqtvivlkgn
qtviafpdgdcwlnptgngalakggtgdtltgmilgmlcchedpkhavlnavylhgacae
lwtdehsahtllahelsdilprvwkrfe

SCOPe Domain Coordinates for d1kyha_:

Click to download the PDB-style file with coordinates for d1kyha_.
(The format of our PDB-style files is described here.)

Timeline for d1kyha_: