Lineage for d1kyda2 (1kyd A:825-938)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332976Fold d.105: Clathrin adaptor appendage, alpha and beta chain-specific domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 332977Superfamily d.105.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55711] (1 family) (S)
  5. 332978Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)
  6. 332979Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species)
  7. 332980Species Mouse (Mus musculus) [TaxId:10090] [55714] (8 PDB entries)
  8. 332987Domain d1kyda2: 1kyd A:825-938 [73219]
    Other proteins in same PDB: d1kyda1
    complexed with so4; mutant

Details for d1kyda2

PDB Entry: 1kyd (more details), 2 Å

PDB Description: ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide

SCOP Domain Sequences for d1kyda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyda2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus)}
ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp
anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf

SCOP Domain Coordinates for d1kyda2:

Click to download the PDB-style file with coordinates for d1kyda2.
(The format of our PDB-style files is described here.)

Timeline for d1kyda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kyda1