SCOP 1.75: Domain d1kyda1: 1kyd A:692-824

Lineage for d1kyda1 (1kyd A:692-824)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families)
   contains an additional N-terminal strand

5. Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
   ear domain consists of two different subdomains

6. Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49351] (10 PDB entries)
   Uniprot P17427 694-938 # 98% sequence identity

8. Domain d1kyda1: 1kyd A:692-824 [73218]
   Other proteins in same PDB: d1kyda2
   complexed with epsin dpw peptide (chain P)
   complexed with so4; mutant

Details for d1kyda1

PDB Entry: 1kyd, 2 Å

PDB Description: ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide

PDB Compounds: (A:) alpha-adaptin c

SCOP Domain Sequences for d1kyda1:

Sequence; same for both SEQRES and ATOM records:

>d1kyda1 b.1.10.1 (A:692-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
gspgirlgssednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfln
ftptlicaddlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtf
qnvsvklpitlnk

Timeline for d1kyda1:

• d1kyda1 first appeared in SCOP 1.61
  
• d1kyda1 appears in SCOP 1.73
  
• d1kyda1 appears in SCOPe 2.01
  
• d1kyda1 appears in the current release, SCOPe 2.08