Lineage for d1kyad3 (1kya D:301-499)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771289Protein Laccase, C-terminal domain [418907] (5 species)
  7. Species Trametes versicolor, laccase 1 [TaxId:5325] [419318] (1 PDB entry)
  8. 2771318Domain d1kyad3: 1kya D:301-499 [73214]
    Other proteins in same PDB: d1kyaa1, d1kyaa2, d1kyab1, d1kyab2, d1kyac1, d1kyac2, d1kyad1, d1kyad2
    complexed with cu, nag, pye, xyd
    has additional insertions and/or extensions that are not grouped together

Details for d1kyad3

PDB Entry: 1kya (more details), 2.4 Å

PDB Description: active laccase from trametes versicolor complexed with 2,5-xylidine
PDB Compounds: (D:) laccase

SCOPe Domain Sequences for d1kyad3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyad3 b.6.1.3 (D:301-499) Laccase, C-terminal domain {Trametes versicolor, laccase 1 [TaxId: 5325]}
nevnlhplvatavpgspvaggvdlainmafnfngtnffingasftpptvpvllqiisgaq
naqdllpsgsvyslpsnadieisfpataaapgaphpfhlhghafavvrsagstvynydnp
ifrdvvstgtpaagdnvtirfrtdnpgpwflhchidfhleagfavvfaedipdvasanpv
pqawsdlcptydardpsdq

SCOPe Domain Coordinates for d1kyad3:

Click to download the PDB-style file with coordinates for d1kyad3.
(The format of our PDB-style files is described here.)

Timeline for d1kyad3: