Lineage for d1kyad1 (1kya D:1-130)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771353Protein Laccase, N-terminal domain [418905] (5 species)
  7. 2771378Species Trametes versicolor, laccase 1 [TaxId:5325] [419316] (1 PDB entry)
  8. 2771382Domain d1kyad1: 1kya D:1-130 [73212]
    Other proteins in same PDB: d1kyaa2, d1kyaa3, d1kyab2, d1kyab3, d1kyac2, d1kyac3, d1kyad2, d1kyad3
    complexed with cu, nag, pye, xyd

Details for d1kyad1

PDB Entry: 1kya (more details), 2.4 Å

PDB Description: active laccase from trametes versicolor complexed with 2,5-xylidine
PDB Compounds: (D:) laccase

SCOPe Domain Sequences for d1kyad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyad1 b.6.1.3 (D:1-130) Laccase, N-terminal domain {Trametes versicolor, laccase 1 [TaxId: 5325]}
gigpvadltitnaavspdgfsrqavvvnggtpgplitgnmgdrfqlnvidnltnhtmlks
tsihwhgffqkgtnwadgpafinqcpissghsflydfqvpdqagtfwyhshlstqycdgl
rgpfvvydpn

SCOPe Domain Coordinates for d1kyad1:

Click to download the PDB-style file with coordinates for d1kyad1.
(The format of our PDB-style files is described here.)

Timeline for d1kyad1: