![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Laccase, N-terminal domain [418905] (5 species) |
![]() | Species Trametes versicolor, laccase 1 [TaxId:5325] [419316] (1 PDB entry) |
![]() | Domain d1kyad1: 1kya D:1-130 [73212] Other proteins in same PDB: d1kyaa2, d1kyaa3, d1kyab2, d1kyab3, d1kyac2, d1kyac3, d1kyad2, d1kyad3 complexed with cu, nag, pye, xyd |
PDB Entry: 1kya (more details), 2.4 Å
SCOPe Domain Sequences for d1kyad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyad1 b.6.1.3 (D:1-130) Laccase, N-terminal domain {Trametes versicolor, laccase 1 [TaxId: 5325]} gigpvadltitnaavspdgfsrqavvvnggtpgplitgnmgdrfqlnvidnltnhtmlks tsihwhgffqkgtnwadgpafinqcpissghsflydfqvpdqagtfwyhshlstqycdgl rgpfvvydpn
Timeline for d1kyad1: