Lineage for d1ky7a2 (1ky7 A:825-938)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730921Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 730922Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) (S)
  5. 730923Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)
  6. 730924Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species)
  7. 730925Species Mouse (Mus musculus) [TaxId:10090] [55714] (9 PDB entries)
  8. 730934Domain d1ky7a2: 1ky7 A:825-938 [73197]
    Other proteins in same PDB: d1ky7a1

Details for d1ky7a2

PDB Entry: 1ky7 (more details), 2.15 Å

PDB Description: the ap-2 clathrin adaptor alpha-appendage in complex with amphiphysin fxdxf
PDB Compounds: (A:) alpha-adaptin c

SCOP Domain Sequences for d1ky7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky7a2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp
anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf

SCOP Domain Coordinates for d1ky7a2:

Click to download the PDB-style file with coordinates for d1ky7a2.
(The format of our PDB-style files is described here.)

Timeline for d1ky7a2: