Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily) beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet |
Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) |
Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins) |
Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [55714] (10 PDB entries) Uniprot P17427 694-938 # 98% sequence identity |
Domain d1ky7a2: 1ky7 A:825-938 [73197] Other proteins in same PDB: d1ky7a1, d1ky7a3 |
PDB Entry: 1ky7 (more details), 2.15 Å
SCOPe Domain Sequences for d1ky7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ky7a2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]} ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf
Timeline for d1ky7a2: