SCOP 1.71: Domain d1ky7a1: 1ky7 A:692-824

Lineage for d1ky7a1 (1ky7 A:692-824)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families)
   contains an additional N-terminal strand

5. Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
   ear domain consists of two different subdomains

6. Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49351] (9 PDB entries)

8. Domain d1ky7a1: 1ky7 A:692-824 [73196]
   Other proteins in same PDB: d1ky7a2
   complexed with amphiphysin fxdxf peptide (chain P)

Details for d1ky7a1

PDB Entry: 1ky7, 2.15 Å

PDB Description: the ap-2 clathrin adaptor alpha-appendage in complex with amphiphysin fxdxf

SCOP Domain Sequences for d1ky7a1:

Sequence; same for both SEQRES and ATOM records:

>d1ky7a1 b.1.10.1 (A:692-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus)}
gspgirlgssednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfln
ftptlicaddlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtf
qnvsvklpitlnk

Timeline for d1ky7a1:

• d1ky7a1 first appeared in SCOP 1.61
  
• d1ky7a1 appears in SCOP 1.69
  
• d1ky7a1 appears in SCOP 1.73
  
• d1ky7a1 appears in the current release, SCOPe 2.08