Lineage for d1ky6a1 (1ky6 A:692-824)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551760Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) (S)
    contains an additional N-terminal strand
  5. 551761Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
    ear domain consists of two different subdomains
  6. 551762Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species)
  7. 551763Species Mouse (Mus musculus) [TaxId:10090] [49351] (9 PDB entries)
  8. 551771Domain d1ky6a1: 1ky6 A:692-824 [73194]
    Other proteins in same PDB: d1ky6a2
    complexed with epsin dpw peptide (chain P)
    complexed with so4

Details for d1ky6a1

PDB Entry: 1ky6 (more details), 2 Å

PDB Description: ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide

SCOP Domain Sequences for d1ky6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky6a1 b.1.10.1 (A:692-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus)}
gspgirlgssednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfln
ftptlicaddlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtf
qnvsvklpitlnk

SCOP Domain Coordinates for d1ky6a1:

Click to download the PDB-style file with coordinates for d1ky6a1.
(The format of our PDB-style files is described here.)

Timeline for d1ky6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ky6a2