Lineage for d1ky3a_ (1ky3 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988164Protein Rab-related protein ypt7p [75199] (1 species)
  7. 988165Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75200] (2 PDB entries)
  8. 988166Domain d1ky3a_: 1ky3 A: [73193]
    complexed with gdp, mg

Details for d1ky3a_

PDB Entry: 1ky3 (more details), 1.35 Å

PDB Description: gdp-bound ypt7p at 1.35 a resolution
PDB Compounds: (A:) GTP-binding protein ypt7p

SCOPe Domain Sequences for d1ky3a_:

Sequence, based on SEQRES records: (download)

>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nilkviilgdsgvgktslmhryvndkysqqykatigadfltkevtvdgdkvatmqvwdta
gqerfqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilgn
kidaeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalqqnq

Sequence, based on observed residues (ATOM records): (download)

>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nilkviilgdsgvgktslmhryvndkysqqyigadfltkevtvdgdkvatmqvwdtaafy
rgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilgnkidaeeskkivse
ksaqelakslgdiplfltsaknainvdtafeeiarsalqqnq

SCOPe Domain Coordinates for d1ky3a_:

Click to download the PDB-style file with coordinates for d1ky3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ky3a_: