Lineage for d1ky2a_ (1ky2 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124747Protein Rab-related protein ypt7p [75199] (1 species)
  7. 2124748Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75200] (2 PDB entries)
  8. 2124750Domain d1ky2a_: 1ky2 A: [73192]
    complexed with gnp, mg

Details for d1ky2a_

PDB Entry: 1ky2 (more details), 1.6 Å

PDB Description: gppnhp-bound ypt7p at 1.6 a resolution
PDB Compounds: (A:) GTP-binding protein ypt7p

SCOPe Domain Sequences for d1ky2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky2a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
srkknilkviilgdsgvgktslmhryvndkysqqykatigadfltkevtvdgdkvatmqv
wdtagqerfqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfv
ilgnkidaeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalqqnqa

SCOPe Domain Coordinates for d1ky2a_:

Click to download the PDB-style file with coordinates for d1ky2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ky2a_: