Lineage for d1ky2a_ (1ky2 A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.8: G proteins [52592] (26 proteins) 
Protein Rab-related protein ypt7p [75199] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75200] (2 PDB entries) 
Domain d1ky2a_: 1ky2 A: [73192]
Details for d1ky2a_
PDB Entry: 1ky2 (more details), 1.6 Å
PDB Description: gppnhp-bound ypt7p at 1.6 a resolution
SCOP Domain Sequences for d1ky2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ky2a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae)}
srkknilkviilgdsgvgktslmhryvndkysqqykatigadfltkevtvdgdkvatmqv
wdtagqerfqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfv
ilgnkidaeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalqqnqa
SCOP Domain Coordinates for d1ky2a_:
Click to download the PDB-style file with coordinates for d1ky2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ky2a_:
- d1ky2a_ is new in SCOP 1.61
- d1ky2a_ appears in SCOP 1.63
- d1ky2a_ appears in the current release, SCOPe 2.08
View in 3D