Lineage for d1kxvd_ (1kxv D:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157732Species Camel (Camelus dromedarius), VHH CAB10 against alpha-amylase [74823] (1 PDB entry)
  8. 157734Domain d1kxvd_: 1kxv D: [73191]
    Other proteins in same PDB: d1kxva1, d1kxva2, d1kxvb1, d1kxvb2

Details for d1kxvd_

PDB Entry: 1kxv (more details), 1.6 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase

SCOP Domain Sequences for d1kxvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxvd_ b.1.1.1 (D:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), VHH CAB10 against alpha-amylase}
qvqlvesgggtvpaggslrlscaasgntlctydmswyrrapgkgrdfvsgidndgtttyv
dsvagrftisqgnakntaylqmdslkpddtamyyckpslryglpgcpiipwgqgtqvtvs
s

SCOP Domain Coordinates for d1kxvd_:

Click to download the PDB-style file with coordinates for d1kxvd_.
(The format of our PDB-style files is described here.)

Timeline for d1kxvd_: