SCOP 1.61: Domain d1kxvc_: 1kxv C:

Lineage for d1kxvc_ (1kxv C:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Camel (Camelus dromedarius), VHH CAB10 against alpha-amylase [74823] (1 PDB entry)

8. Domain d1kxvc_: 1kxv C: [73190]
   Other proteins in same PDB: d1kxva1, d1kxva2, d1kxvb1, d1kxvb2

Details for d1kxvc_

PDB Entry: 1kxv, 1.6 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase

SCOP Domain Sequences for d1kxvc_:

Sequence; same for both SEQRES and ATOM records:

>d1kxvc_ b.1.1.1 (C:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), VHH CAB10 against alpha-amylase}
vqlvesgggtvpaggslrlscaasgntlctydmswyrrapgkgrdfvsgidndgtttyvd
svagrftisqgnakntaylqmdslkpddtamyyckpslryglpgcpiipwgqgtqvtvs

Timeline for d1kxvc_:

• d1kxvc_ is new in SCOP 1.61
  
• d1kxvc_ appears in SCOP 1.63
  
• d1kxvc_ appears in the current release, SCOPe 2.08