Lineage for d1kxvb1 (1kxv B:404-496)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 302223Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 302224Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families) (S)
  5. 302225Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 302252Protein Animal alpha-amylase [51024] (3 species)
  7. 302272Species Pig (Sus scrofa) [TaxId:9823] [51025] (11 PDB entries)
  8. 302279Domain d1kxvb1: 1kxv B:404-496 [73188]
    Other proteins in same PDB: d1kxva2, d1kxvb2, d1kxvc_, d1kxvd_

Details for d1kxvb1

PDB Entry: 1kxv (more details), 1.6 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase
PDB Compounds: (B:)

SCOP Domain Sequences for d1kxvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxvb1 b.71.1.1 (B:404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1kxvb1:

Click to download the PDB-style file with coordinates for d1kxvb1.
(The format of our PDB-style files is described here.)

Timeline for d1kxvb1: