Lineage for d1kxvb1 (1kxv B:404-496)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170927Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 170928Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 170929Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins)
  6. 170945Protein Animal alpha-amylase [51024] (3 species)
  7. 170963Species Pig (Sus scrofa) [TaxId:9823] [51025] (11 PDB entries)
  8. 170970Domain d1kxvb1: 1kxv B:404-496 [73188]
    Other proteins in same PDB: d1kxva2, d1kxvb2, d1kxvc_, d1kxvd_

Details for d1kxvb1

PDB Entry: 1kxv (more details), 1.6 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase

SCOP Domain Sequences for d1kxvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxvb1 b.71.1.1 (B:404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1kxvb1:

Click to download the PDB-style file with coordinates for d1kxvb1.
(The format of our PDB-style files is described here.)

Timeline for d1kxvb1: