Lineage for d1kxte1 (1kxt E:404-496)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2076899Protein Animal alpha-amylase [51024] (3 species)
  7. 2076954Species Pig (Sus scrofa) [TaxId:9823] [51025] (13 PDB entries)
  8. 2076970Domain d1kxte1: 1kxt E:404-496 [73183]
    Other proteins in same PDB: d1kxta2, d1kxtb_, d1kxtc2, d1kxtd_, d1kxte2, d1kxtf_
    complexed with ca, cl

Details for d1kxte1

PDB Entry: 1kxt (more details), 2 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase
PDB Compounds: (E:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1kxte1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxte1 b.71.1.1 (E:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d1kxte1:

Click to download the PDB-style file with coordinates for d1kxte1.
(The format of our PDB-style files is described here.)

Timeline for d1kxte1: