SCOP 1.67: Domain d1kxtc1: 1kxt C:404-496

Lineage for d1kxtc1 (1kxt C:404-496)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51025] (12 PDB entries)

8. Domain d1kxtc1: 1kxt C:404-496 [73180]
   Other proteins in same PDB: d1kxta2, d1kxtb_, d1kxtc2, d1kxtd_, d1kxte2, d1kxtf_

Details for d1kxtc1

PDB Entry: 1kxt, 2 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase

SCOP Domain Sequences for d1kxtc1:

Sequence; same for both SEQRES and ATOM records:

>d1kxtc1 b.71.1.1 (C:404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

Timeline for d1kxtc1:

• d1kxtc1 first appeared in SCOP 1.61
  
• d1kxtc1 appears in SCOP 1.65
  
• d1kxtc1 appears in SCOP 1.69
  
• d1kxtc1 appears in the current release, SCOPe 2.08