Lineage for d1kxtc1 (1kxt C:404-496)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170927Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 170928Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 170929Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins)
  6. 170945Protein Animal alpha-amylase [51024] (3 species)
  7. 170963Species Pig (Sus scrofa) [TaxId:9823] [51025] (11 PDB entries)
  8. 170975Domain d1kxtc1: 1kxt C:404-496 [73180]
    Other proteins in same PDB: d1kxta2, d1kxtb_, d1kxtc2, d1kxtd_, d1kxte2, d1kxtf_

Details for d1kxtc1

PDB Entry: 1kxt (more details), 2 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase

SCOP Domain Sequences for d1kxtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxtc1 b.71.1.1 (C:404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1kxtc1:

Click to download the PDB-style file with coordinates for d1kxtc1.
(The format of our PDB-style files is described here.)

Timeline for d1kxtc1: