Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (21 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Animal alpha-amylase [51458] (3 species) contains Ca2+-binding subdomain, residues 100-170 |
Species Pig (Sus scrofa) [TaxId:9823] [51459] (11 PDB entries) |
Domain d1kxta2: 1kxt A:1-403 [73178] Other proteins in same PDB: d1kxta1, d1kxtb_, d1kxtc1, d1kxtd_, d1kxte1, d1kxtf_ |
PDB Entry: 1kxt (more details), 2 Å
SCOP Domain Sequences for d1kxta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxta2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa)} qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdg
Timeline for d1kxta2: