SCOP 1.61: Domain d1kxrb_: 1kxr B:

Lineage for d1kxrb_ (1kxr B:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)

4. Superfamily d.3.1: Cysteine proteinases [54001] (8 families)

5. Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)

6. Protein Calpain large subunit, catalytic domain (domain II) [54041] (3 species)

7. Species Rat (Rattus norvegicus), isozyme I [TaxId:10116] [75332] (1 PDB entry)

8. Domain d1kxrb_: 1kxr B: [73176]

Details for d1kxrb_

PDB Entry: 1kxr, 2.07 Å

PDB Description: crystal structure of calcium-bound protease core of calpain i

SCOP Domain Sequences for d1kxrb_:

Sequence; same for both SEQRES and ATOM records:

>d1kxrb_ d.3.1.3 (B:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), isozyme I}
naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdswllaaiasltlnetilhrvvpygqsfqegyagifhfq
lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
efwmsfrdfireftkleicnl

Timeline for d1kxrb_:

• d1kxrb_ is new in SCOP 1.61
  
• d1kxrb_ appears in SCOP 1.63
  
• d1kxrb_ appears in the current release, SCOPe 2.08