Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Camel (Camelus dromedarius), VHH CABAMD9 against alpha-amylase [74822] (1 PDB entry) |
Domain d1kxqg_: 1kxq G: [73173] Other proteins in same PDB: d1kxqa1, d1kxqa2, d1kxqb1, d1kxqb2, d1kxqc1, d1kxqc2, d1kxqd1, d1kxqd2 |
PDB Entry: 1kxq (more details), 1.6 Å
SCOP Domain Sequences for d1kxqg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxqg_ b.1.1.1 (G:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), VHH CABAMD9 against alpha-amylase} qvqlvesgggsvqaggslslscaastytdtvgwfrqapgkeregvaaiyrrtgytysads vkgrftlsqdnnkntvylqmnslkpedtgiyycatgnsvrlaswegyfywgqgtqvtvss
Timeline for d1kxqg_: