Lineage for d1kxqd1 (1kxq D:404-496)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 302223Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 302224Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families) (S)
  5. 302225Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 302252Protein Animal alpha-amylase [51024] (3 species)
  7. 302272Species Pig (Sus scrofa) [TaxId:9823] [51025] (11 PDB entries)
  8. 302277Domain d1kxqd1: 1kxq D:404-496 [73169]
    Other proteins in same PDB: d1kxqa2, d1kxqb2, d1kxqc2, d1kxqd2, d1kxqe_, d1kxqf_, d1kxqg_, d1kxqh_
    complexed with ca, cl

Details for d1kxqd1

PDB Entry: 1kxq (more details), 1.6 Å

PDB Description: camelid vhh domain in complex with porcine pancreatic alpha-amylase
PDB Compounds: (D:)

SCOP Domain Sequences for d1kxqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxqd1 b.71.1.1 (D:404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1kxqd1:

Click to download the PDB-style file with coordinates for d1kxqd1.
(The format of our PDB-style files is described here.)

Timeline for d1kxqd1: