SCOP 1.65: Domain d1kxqc1: 1kxq C:404-496

Lineage for d1kxqc1 (1kxq C:404-496)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51025] (11 PDB entries)

8. Domain d1kxqc1: 1kxq C:404-496 [73167]
   Other proteins in same PDB: d1kxqa2, d1kxqb2, d1kxqc2, d1kxqd2, d1kxqe_, d1kxqf_, d1kxqg_, d1kxqh_

Details for d1kxqc1

PDB Entry: 1kxq, 1.6 Å

PDB Description: camelid vhh domain in complex with porcine pancreatic alpha-amylase

SCOP Domain Sequences for d1kxqc1:

Sequence; same for both SEQRES and ATOM records:

>d1kxqc1 b.71.1.1 (C:404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

Timeline for d1kxqc1:

• d1kxqc1 first appeared in SCOP 1.61
  
• d1kxqc1 appears in SCOP 1.63
  
• d1kxqc1 appears in SCOP 1.67
  
• d1kxqc1 appears in the current release, SCOPe 2.08