SCOP 1.71: Domain d1kxpa1: 1kxp A:4-146

Lineage for d1kxpa1 (1kxp A:4-146)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (20 PDB entries)

8. Domain d1kxpa1: 1kxp A:4-146 [73158]
   Other proteins in same PDB: d1kxpd1, d1kxpd2, d1kxpd3

Details for d1kxpa1

PDB Entry: 1kxp, 2.1 Å

PDB Description: crystal structure of human vitamin d-binding protein in complex with skeletal actin

SCOP Domain Sequences for d1kxpa1:

Sequence, based on SEQRES records:

>d1kxpa1 c.55.1.1 (A:4-146) Actin {Rabbit (Oryctolagus cuniculus)}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1kxpa1 c.55.1.1 (A:4-146) Actin {Rabbit (Oryctolagus cuniculus)}
ettalvcdngsglvkagfagddapravfpsivgrprsyvgdeaqskrgiltlkypiehgi
itnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyva
iqavlslyasg

Timeline for d1kxpa1:

• d1kxpa1 first appeared in SCOP 1.61
  
• d1kxpa1 appears in SCOP 1.69
  
• d1kxpa1 appears in SCOP 1.73
  
• d1kxpa1 appears in the current release, SCOPe 2.08