Lineage for d1kxna_ (1kxn A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154837Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 154838Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 154839Family a.93.1.1: CCP-like [48114] (6 proteins)
  6. 154846Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 154847Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (75 PDB entries)
  8. 154860Domain d1kxna_: 1kxn A: [73157]

Details for d1kxna_

PDB Entry: 1kxn (more details), 1.8 Å

PDB Description: crystal structure of cytochrome c peroxidase with a proposed electron transfer pathway excised to form a ligand binding channel.

SCOP Domain Sequences for d1kxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxna_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d1kxna_:

Click to download the PDB-style file with coordinates for d1kxna_.
(The format of our PDB-style files is described here.)

Timeline for d1kxna_: