SCOP 1.69: Domain d1kxma_: 1kxm A:

Lineage for d1kxma_ (1kxm A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (85 PDB entries)

8. Domain d1kxma_: 1kxm A: [73156]
   proposed electron transfer pathway excised to form a ligand binding channel

Details for d1kxma_

PDB Entry: 1kxm, 1.74 Å

PDB Description: crystal structure of cytochrome c peroxidase with a proposed electron transfer pathway excised to form a ligand binding channel.

SCOP Domain Sequences for d1kxma_:

Sequence; same for both SEQRES and ATOM records:

>d1kxma_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
knsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpky
lsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d1kxma_:

• d1kxma_ first appeared in SCOP 1.61
  
• d1kxma_ appears in SCOP 1.67
  
• d1kxma_ appears in SCOP 1.71
  
• d1kxma_ appears in the current release, SCOPe 2.08, called d1kxma1