Lineage for d1kxla_ (1kxl A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668080Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 668085Protein CDC13 ssDNA-binding domain [74948] (1 species)
  7. 668086Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74949] (2 PDB entries)
  8. 668087Domain d1kxla_: 1kxl A: [73155]

Details for d1kxla_

PDB Entry: 1kxl (more details)

PDB Description: solution structure of the cdc13 dna-binding domain in a complex with single-stranded telomeric dna (dna structure not modeled)
PDB Compounds: (A:) cell division control protein 13

SCOP Domain Sequences for d1kxla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxla_ b.40.4.3 (A:) CDC13 ssDNA-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kmarkdptiefcqlgldtfetkyitmfgmlvscsfdkpafisfvfsdftkndivqnylyd
rylidyenklelnegfkaimyknqfetfdsklrkifnnglrdlqngrdenlsqygivckm
nikvkmyngklnaivrecepvphsqissiaspsqcehlrlfyqrafkrigesaisryfee
yrrffpi

SCOP Domain Coordinates for d1kxla_:

Click to download the PDB-style file with coordinates for d1kxla_.
(The format of our PDB-style files is described here.)

Timeline for d1kxla_: