Lineage for d1kxla_ (1kxl A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2382816Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 protein domains)
    barrel, closed; n=5, S=10
  6. 2382821Protein CDC13 ssDNA-binding domain [74948] (1 species)
  7. 2382822Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74949] (2 PDB entries)
  8. 2382823Domain d1kxla_: 1kxl A: [73155]
    protein/DNA complex

Details for d1kxla_

PDB Entry: 1kxl (more details)

PDB Description: Solution Structure of the Cdc13 DNA-binding Domain in a Complex with Single-Stranded Telomeric DNA (DNA structure not modeled)
PDB Compounds: (A:) cell division control protein 13

SCOPe Domain Sequences for d1kxla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxla_ b.40.4.3 (A:) CDC13 ssDNA-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kmarkdptiefcqlgldtfetkyitmfgmlvscsfdkpafisfvfsdftkndivqnylyd
rylidyenklelnegfkaimyknqfetfdsklrkifnnglrdlqngrdenlsqygivckm
nikvkmyngklnaivrecepvphsqissiaspsqcehlrlfyqrafkrigesaisryfee
yrrffpi

SCOPe Domain Coordinates for d1kxla_:

Click to download the PDB-style file with coordinates for d1kxla_.
(The format of our PDB-style files is described here.)

Timeline for d1kxla_: