![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
![]() | Protein CDC13 ssDNA-binding domain [74948] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74949] (2 PDB entries) |
![]() | Domain d1kxla_: 1kxl A: [73155] protein/DNA complex has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1kxl (more details)
SCOPe Domain Sequences for d1kxla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxla_ b.40.4.3 (A:) CDC13 ssDNA-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kmarkdptiefcqlgldtfetkyitmfgmlvscsfdkpafisfvfsdftkndivqnylyd rylidyenklelnegfkaimyknqfetfdsklrkifnnglrdlqngrdenlsqygivckm nikvkmyngklnaivrecepvphsqissiaspsqcehlrlfyqrafkrigesaisryfee yrrffpi
Timeline for d1kxla_: