Lineage for d1kxja1 (1kxj A:1-201)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2117753Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2117828Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)
  7. 2117838Species Thermotoga maritima [TaxId:2336] [69448] (6 PDB entries)
  8. 2117849Domain d1kxja1: 1kxj A:1-201 [73153]
    Other proteins in same PDB: d1kxja2, d1kxjb2
    complexed with po4

Details for d1kxja1

PDB Entry: 1kxj (more details), 2.8 Å

PDB Description: the crystal structure of glutamine amidotransferase from thermotoga maritima
PDB Compounds: (A:) amidotransferase hish

SCOPe Domain Sequences for d1kxja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxja1 c.23.16.1 (A:1-201) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
ksskigrkllekviecslsrr

SCOPe Domain Coordinates for d1kxja1:

Click to download the PDB-style file with coordinates for d1kxja1.
(The format of our PDB-style files is described here.)

Timeline for d1kxja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kxja2