Lineage for d1kxha1 (1kxh A:355-448)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 675783Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 675874Protein Bacterial alpha-Amylase [51013] (9 species)
  7. 675911Species Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId:228] [51015] (9 PDB entries)
  8. 675917Domain d1kxha1: 1kxh A:355-448 [73151]
    Other proteins in same PDB: d1kxha2
    complexed with acr, ca, cl; mutant

Details for d1kxha1

PDB Entry: 1kxh (more details), 2.3 Å

PDB Description: crystal structure of the complex between an inactive mutant of psychrophilic alpha-amylase (d174n) and acarbose
PDB Compounds: (A:) alpha-amylase

SCOP Domain Sequences for d1kxha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxha1 b.71.1.1 (A:355-448) Bacterial alpha-Amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln

SCOP Domain Coordinates for d1kxha1:

Click to download the PDB-style file with coordinates for d1kxha1.
(The format of our PDB-style files is described here.)

Timeline for d1kxha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kxha2