Lineage for d1kx1e1 (1kx1 E:105-221)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878002Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 878003Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 878004Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 878112Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 878115Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 878215Domain d1kx1e1: 1kx1 E:105-221 [73141]
    Other proteins in same PDB: d1kx1a2, d1kx1b2, d1kx1c2, d1kx1d2, d1kx1e2, d1kx1f2

Details for d1kx1e1

PDB Entry: 1kx1 (more details), 2.8 Å

PDB Description: rat mannose protein a complexed with man6-glcnac2-asn
PDB Compounds: (E:) mannose-binding protein a

SCOP Domain Sequences for d1kx1e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx1e1 d.169.1.1 (E:105-221) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

SCOP Domain Coordinates for d1kx1e1:

Click to download the PDB-style file with coordinates for d1kx1e1.
(The format of our PDB-style files is described here.)

Timeline for d1kx1e1: