SCOPe 2.03: Domain d1kx1b1: 1kx1 B:105-221

Lineage for d1kx1b1 (1kx1 B:105-221)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1kx1b1: 1kx1 B:105-221 [73135]
   Other proteins in same PDB: d1kx1a2, d1kx1b2, d1kx1c2, d1kx1d2, d1kx1e2, d1kx1f2
   complexed with ca, man

Details for d1kx1b1

PDB Entry: 1kx1, 2.8 Å

PDB Description: rat mannose protein a complexed with man6-glcnac2-asn

PDB Compounds: (B:) mannose-binding protein a

SCOPe Domain Sequences for d1kx1b1:

Sequence; same for both SEQRES and ATOM records:

>d1kx1b1 d.169.1.1 (B:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

Timeline for d1kx1b1:

• d1kx1b1 first appeared in SCOP 1.61
  
• d1kx1b1 appears in SCOPe 2.02
  
• d1kx1b1 appears in SCOPe 2.04
  
• d1kx1b1 appears in the current release, SCOPe 2.08