| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (26 proteins) Pfam 00059 |
| Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d1kx1a1: 1kx1 A:105-221 [73133] Other proteins in same PDB: d1kx1a2, d1kx1b2, d1kx1c2, d1kx1d2, d1kx1e2, d1kx1f2 |
PDB Entry: 1kx1 (more details), 2.8 Å
SCOP Domain Sequences for d1kx1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kx1a1 d.169.1.1 (A:105-221) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa
Timeline for d1kx1a1: