SCOP 1.67: Domain d1kx0a1: 1kx0 A:105-221

Lineage for d1kx0a1 (1kx0 A:105-221)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (22 proteins)

6. Protein Mannose-binding protein A, lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1kx0a1: 1kx0 A:105-221 [73127]
   Other proteins in same PDB: d1kx0a2, d1kx0b2, d1kx0c2

Details for d1kx0a1

PDB Entry: 1kx0, 2 Å

PDB Description: rat mannose protein a (h189v i207v) complexed with man-a13-man

SCOP Domain Sequences for d1kx0a1:

Sequence; same for both SEQRES and ATOM records:

>d1kx0a1 d.169.1.1 (A:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndvgsgedcvtivdnglwndvscqashtavcefpa

Timeline for d1kx0a1:

• d1kx0a1 first appeared in SCOP 1.61
  
• d1kx0a1 appears in SCOP 1.65
  
• d1kx0a1 appears in SCOP 1.69
  
• d1kx0a1 appears in the current release, SCOPe 2.08