Lineage for d1kwyc1 (1kwy C:105-221)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001519Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 3001522Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 3001573Domain d1kwyc1: 1kwy C:105-221 [73119]
    Other proteins in same PDB: d1kwya2, d1kwyb2, d1kwyc2
    complexed with ca, cl

Details for d1kwyc1

PDB Entry: 1kwy (more details), 2 Å

PDB Description: rat mannose protein a complexed with man-a13-man.
PDB Compounds: (C:) mannose-binding protein a

SCOPe Domain Sequences for d1kwyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwyc1 d.169.1.1 (C:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

SCOPe Domain Coordinates for d1kwyc1:

Click to download the PDB-style file with coordinates for d1kwyc1.
(The format of our PDB-style files is described here.)

Timeline for d1kwyc1: