SCOP 1.65: Domain d1kwxa1: 1kwx A:105-221

Lineage for d1kwxa1 (1kwx A:105-221)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (21 proteins)

6. Protein Mannose-binding protein A, lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1kwxa1: 1kwx A:105-221 [73109]
   Other proteins in same PDB: d1kwxa2, d1kwxb2, d1kwxc2

Details for d1kwxa1

PDB Entry: 1kwx, 2 Å

PDB Description: rat mannose protein a complexed with b-me-fuc.

SCOP Domain Sequences for d1kwxa1:

Sequence; same for both SEQRES and ATOM records:

>d1kwxa1 d.169.1.1 (A:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

Timeline for d1kwxa1:

• d1kwxa1 first appeared in SCOP 1.61
  
• d1kwxa1 appears in SCOP 1.63
  
• d1kwxa1 appears in SCOP 1.67
  
• d1kwxa1 appears in the current release, SCOPe 2.08