Lineage for d1kwvc1 (1kwv C:105-221)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 737998Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 738001Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 738073Domain d1kwvc1: 1kwv C:105-221 [73101]
    Other proteins in same PDB: d1kwva2, d1kwvb2, d1kwvc2
    complexed with ca, cl, nag

Details for d1kwvc1

PDB Entry: 1kwv (more details), 2 Å

PDB Description: rat mannose binding protein a complexed with a-me-glcnac
PDB Compounds: (C:) mannose-binding protein a

SCOP Domain Sequences for d1kwvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwvc1 d.169.1.1 (C:105-221) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

SCOP Domain Coordinates for d1kwvc1:

Click to download the PDB-style file with coordinates for d1kwvc1.
(The format of our PDB-style files is described here.)

Timeline for d1kwvc1: