SCOP 1.65: Domain d1kwvb1: 1kwv B:105-221

Lineage for d1kwvb1 (1kwv B:105-221)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (21 proteins)

6. Protein Mannose-binding protein A, lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1kwvb1: 1kwv B:105-221 [73099]
   Other proteins in same PDB: d1kwva2, d1kwvb2, d1kwvc2

Details for d1kwvb1

PDB Entry: 1kwv, 2 Å

PDB Description: rat mannose binding protein a complexed with a-me-glcnac

SCOP Domain Sequences for d1kwvb1:

Sequence; same for both SEQRES and ATOM records:

>d1kwvb1 d.169.1.1 (B:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

Timeline for d1kwvb1:

• d1kwvb1 first appeared in SCOP 1.61
  
• d1kwvb1 appears in SCOP 1.63
  
• d1kwvb1 appears in SCOP 1.67
  
• d1kwvb1 appears in the current release, SCOPe 2.08