Lineage for d1kwsb_ (1kws B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133441Family c.68.1.7: 1,3-glucuronyltransferase [53467] (3 protein domains)
    automatically mapped to Pfam PF03360
  6. 2133442Protein 1,3-Glucuronyltransferase I (glcAT-I) [53468] (1 species)
  7. 2133443Species Human (Homo sapiens) [TaxId:9606] [53469] (3 PDB entries)
  8. 2133447Domain d1kwsb_: 1kws B: [73084]
    Other proteins in same PDB: d1kwsa2
    complexed with mn, uga

Details for d1kwsb_

PDB Entry: 1kws (more details), 2.1 Å

PDB Description: crystal structure of beta1,3-glucuronyltransferase i in complex with the active udp-glcua donor
PDB Compounds: (B:) beta-1,3-glucuronyltransferase 3

SCOPe Domain Sequences for d1kwsb_:

Sequence, based on SEQRES records: (download)

>d1kwsb_ c.68.1.7 (B:) 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo sapiens) [TaxId: 9606]}
mtiyvvtptyarlvqkaelvrlsqtlslvprlhwllvedaegptplvsgllaasgllfth
lvvltpkaqrlregepgwvhprgveqrnkaldwlrgrggavggekdppppgtqgvvyfad
ddntysrelfeemrwtrgvsvwpvglvgglrfegpqvqdgrvvgfhtawepsrpfpvdma
gfavalpllldkpnaqfdstaprghlessllshlvdpkdlepraanctrvlvwhtrtekp
kmkqeeqlqrqgrgsdpaiev

Sequence, based on observed residues (ATOM records): (download)

>d1kwsb_ c.68.1.7 (B:) 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo sapiens) [TaxId: 9606]}
mtiyvvtptyarlvqkaelvrlsqtlslvprlhwllvedaegptplvsgllaasgllfth
lvvltphprgveqrnkaldwlrgrggavggekdppppgtqgvvyfadddntysrelfeem
rwtrgvsvwpvglvgglrfegpqvqdgrvvgfhtawerpfpvdmagfavalpllldkpna
qfdstapghlessllshlvdpkdlepraanctrvlvwhtrtekpkmkqeeqlqrqgrgsd
paiev

SCOPe Domain Coordinates for d1kwsb_:

Click to download the PDB-style file with coordinates for d1kwsb_.
(The format of our PDB-style files is described here.)

Timeline for d1kwsb_: