Lineage for d1kwsa1 (1kws A:76-335)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133441Family c.68.1.7: 1,3-glucuronyltransferase [53467] (3 protein domains)
    automatically mapped to Pfam PF03360
  6. 2133442Protein 1,3-Glucuronyltransferase I (glcAT-I) [53468] (1 species)
  7. 2133443Species Human (Homo sapiens) [TaxId:9606] [53469] (3 PDB entries)
  8. 2133446Domain d1kwsa1: 1kws A:76-335 [73083]
    Other proteins in same PDB: d1kwsa2
    complexed with mn, uga

Details for d1kwsa1

PDB Entry: 1kws (more details), 2.1 Å

PDB Description: crystal structure of beta1,3-glucuronyltransferase i in complex with the active udp-glcua donor
PDB Compounds: (A:) beta-1,3-glucuronyltransferase 3

SCOPe Domain Sequences for d1kwsa1:

Sequence, based on SEQRES records: (download)

>d1kwsa1 c.68.1.7 (A:76-335) 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo sapiens) [TaxId: 9606]}
tiyvvtptyarlvqkaelvrlsqtlslvprlhwllvedaegptplvsgllaasgllfthl
vvltpkaqrlregepgwvhprgveqrnkaldwlrgrggavggekdppppgtqgvvyfadd
dntysrelfeemrwtrgvsvwpvglvgglrfegpqvqdgrvvgfhtawepsrpfpvdmag
favalpllldkpnaqfdstaprghlessllshlvdpkdlepraanctrvlvwhtrtekpk
mkqeeqlqrqgrgsdpaiev

Sequence, based on observed residues (ATOM records): (download)

>d1kwsa1 c.68.1.7 (A:76-335) 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo sapiens) [TaxId: 9606]}
tiyvvtptyarlvqkaelvrlsqtlslvprlhwllvedaegptplvsgllaasgllfthl
vvltpwvhprgveqrnkaldwlrgrggavggekdppppgtqgvvyfadddntysrelfee
mrwtrgvsvwpvglvgglrfegpqvqdgrvvgfhtawepsrpfpvdmagfavalpllldk
pnaqfdstaprghlessllshlvdpkdlepraanctrvlvwhtrtekpkmkqeeqlqrqg
rgsdpaiev

SCOPe Domain Coordinates for d1kwsa1:

Click to download the PDB-style file with coordinates for d1kwsa1.
(The format of our PDB-style files is described here.)

Timeline for d1kwsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kwsa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1kwsb_