SCOPe 2.07: Domain d1kwmb2: 1kwm B:1A-95A

Lineage for d1kwmb2 (1kwm B:1A-95A)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families)

5. Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)

6. Protein Procarboxypeptidase B [54903] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75430] (1 PDB entry)

8. Domain d1kwmb2: 1kwm B:1A-95A [73082]
   Other proteins in same PDB: d1kwma1, d1kwmb1
   complexed with cit, zn

Details for d1kwmb2

PDB Entry: 1kwm, 1.6 Å

PDB Description: Human procarboxypeptidase B: Three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI)

PDB Compounds: (B:) Procarboxypeptidase B

SCOPe Domain Sequences for d1kwmb2:

Sequence; same for both SEQRES and ATOM records:

>d1kwmb2 d.58.3.1 (B:1A-95A) Procarboxypeptidase B {Human (Homo sapiens) [TaxId: 9606]}
hhggehfegekvfrvnvedenhiniirelasttqidfwkpdsvtqikphstvdfrvkaed
tvtvenvlkqnelqykvlisnlrnvveaqfdsrvr

Timeline for d1kwmb2:

• d1kwmb2 first appeared in SCOP 1.61
  
• d1kwmb2 appears in SCOPe 2.06
  
• d1kwmb2 appears in the current release, SCOPe 2.08