Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) |
Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins) |
Protein Procarboxypeptidase B [54903] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [75430] (1 PDB entry) |
Domain d1kwmb2: 1kwm B:1A-95A [73082] Other proteins in same PDB: d1kwma1, d1kwmb1 complexed with cit, zn |
PDB Entry: 1kwm (more details), 1.6 Å
SCOPe Domain Sequences for d1kwmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kwmb2 d.58.3.1 (B:1A-95A) Procarboxypeptidase B {Human (Homo sapiens) [TaxId: 9606]} hhggehfegekvfrvnvedenhiniirelasttqidfwkpdsvtqikphstvdfrvkaed tvtvenvlkqnelqykvlisnlrnvveaqfdsrvr
Timeline for d1kwmb2: