SCOPe 2.07: Domain d1kwmb1: 1kwm B:4-309

Lineage for d1kwmb1 (1kwm B:4-309)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase B [53193] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75248] (2 PDB entries)

8. Domain d1kwmb1: 1kwm B:4-309 [73081]
   Other proteins in same PDB: d1kwma2, d1kwmb2
   zymogen
   complexed with cit, zn

Details for d1kwmb1

PDB Entry: 1kwm, 1.6 Å

PDB Description: Human procarboxypeptidase B: Three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI)

PDB Compounds: (B:) Procarboxypeptidase B

SCOPe Domain Sequences for d1kwmb1:

Sequence; same for both SEQRES and ATOM records:

>d1kwmb1 c.56.5.1 (B:4-309) Carboxypeptidase B {Human (Homo sapiens) [TaxId: 9606]}
atghsyekynkwetieawtqqvatenpalisrsvigttfegraiyllkvgkagqnkpaif
mdcgfharewispafcqwfvreavrtygreiqvtellnkldfyvlpvlnidgyiytwtks
rfwrktrsthtgsscigtdpnrnfdagwceigasrnpcdetycgpaaeseketkaladfi
rnklssikayltihsysqmmiypysyayklgennaelnalakatvkelaslhgtkytygp
gattiypaaggsddwaydqgirysftfelrdtgrygfllpesqiratceetflaikyvas
yvlehly

Timeline for d1kwmb1:

• d1kwmb1 first appeared in SCOP 1.61
  
• d1kwmb1 appears in SCOPe 2.06
  
• d1kwmb1 appears in the current release, SCOPe 2.08