Lineage for d1kwmb1 (1kwm B:4-309)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 182572Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 182719Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 182720Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins)
  6. 182762Protein Carboxypeptidase B [53193] (3 species)
  7. 182765Species Human (Homo sapiens) [TaxId:9606] [75248] (1 PDB entry)
  8. 182767Domain d1kwmb1: 1kwm B:4-309 [73081]
    Other proteins in same PDB: d1kwma2, d1kwmb2

Details for d1kwmb1

PDB Entry: 1kwm (more details), 1.6 Å

PDB Description: Human procarboxypeptidase B: Three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI)

SCOP Domain Sequences for d1kwmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwmb1 c.56.5.1 (B:4-309) Carboxypeptidase B {Human (Homo sapiens)}
atghsyekynkwetieawtqqvatenpalisrsvigttfegraiyllkvgkagqnkpaif
mdcgfharewispafcqwfvreavrtygreiqvtellnkldfyvlpvlnidgyiytwtks
rfwrktrsthtgsscigtdpnrnfdagwceigasrnpcdetycgpaaeseketkaladfi
rnklssikayltihsysqmmiypysyayklgennaelnalakatvkelaslhgtkytygp
gattiypaaggsddwaydqgirysftfelrdtgrygfllpesqiratceetflaikyvas
yvlehly

SCOP Domain Coordinates for d1kwmb1:

Click to download the PDB-style file with coordinates for d1kwmb1.
(The format of our PDB-style files is described here.)

Timeline for d1kwmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kwmb2