Lineage for d1kwmb1 (1kwm B:4-309)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889495Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2889562Protein Carboxypeptidase B [53193] (4 species)
  7. 2889568Species Human (Homo sapiens) [TaxId:9606] [75248] (2 PDB entries)
  8. 2889570Domain d1kwmb1: 1kwm B:4-309 [73081]
    Other proteins in same PDB: d1kwma2, d1kwmb2
    zymogen
    complexed with cit, zn

Details for d1kwmb1

PDB Entry: 1kwm (more details), 1.6 Å

PDB Description: Human procarboxypeptidase B: Three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI)
PDB Compounds: (B:) Procarboxypeptidase B

SCOPe Domain Sequences for d1kwmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwmb1 c.56.5.1 (B:4-309) Carboxypeptidase B {Human (Homo sapiens) [TaxId: 9606]}
atghsyekynkwetieawtqqvatenpalisrsvigttfegraiyllkvgkagqnkpaif
mdcgfharewispafcqwfvreavrtygreiqvtellnkldfyvlpvlnidgyiytwtks
rfwrktrsthtgsscigtdpnrnfdagwceigasrnpcdetycgpaaeseketkaladfi
rnklssikayltihsysqmmiypysyayklgennaelnalakatvkelaslhgtkytygp
gattiypaaggsddwaydqgirysftfelrdtgrygfllpesqiratceetflaikyvas
yvlehly

SCOPe Domain Coordinates for d1kwmb1:

Click to download the PDB-style file with coordinates for d1kwmb1.
(The format of our PDB-style files is described here.)

Timeline for d1kwmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kwmb2